PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G169400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 331aa    MW: 36527.9 Da    PI: 5.8287
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G169400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-1799145148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg WT+eEd  l ++ +++G++ W+ Iar+++  Rt+kqc++rw ++l
  Sevir.9G169400.1.p  99 RGQWTPEEDTMLQELMERHGKRAWSDIAREFP-DRTGKQCRERWINHL 145
                         89******************************.************996 PP

2Myb_DNA-binding45.71.5e-14152192244
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                         ++WT++E++ lv+++k++G++ W +Iar+++ gR ++++k+ +
  Sevir.9G169400.1.p 152 MAWTEDEELMLVKYHKKFGKK-WVKIARHIP-GRPENSIKNQY 192
                         58*******************.*********.********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.94894149IPR017930Myb domain
SuperFamilySSF466892.37E-2997192IPR009057Homeodomain-like
SMARTSM007176.1E-1698147IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-26100152IPR009057Homeodomain-like
CDDcd001672.02E-15102145No hitNo description
PfamPF139214.6E-18102159No hitNo description
SMARTSM007171.8E-10150198IPR001005SANT/Myb domain
PROSITE profilePS5129411.063150200IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-17153192IPR009057Homeodomain-like
CDDcd001671.78E-11153192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MAIRIGEKSS MFYEMFERDE QHALGQQDVT IDQAINFGVD DYKIPLKGAS GFNKGHGGDP  60
IQDTPITEDH GQMIDSLALK KVVGKAYDGS SPTGNNATRG QWTPEEDTML QELMERHGKR  120
AWSDIAREFP DRTGKQCRER WINHLDPEIK NMAWTEDEEL MLVKYHKKFG KKWVKIARHI  180
PGRPENSIKN QYAAERSLET KRKNKSKETR PSIVADYIRG LKEEEEGKGT PAVPTSPVHA  240
AGSGQEINNE VKVPFPGSNF AAASSQAPAS GDNPVPPSSS MSAPFLGRNA GDHFPLEAMY  300
DDPVFIDGHQ EPFAYPPGEW IPAGAGAPLC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-279819426122MYB TRANSFORMING PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012704394.10.0PREDICTED: transcription factor MYB104-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3220534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-42myb domain protein 98